Search results for "Drosophila Montana"

showing 10 items of 26 documents

Strength of sexual and postmating prezygotic barriers varies between sympatric populations with different histories and species abundances.

2019

The impact of different reproductive barriers on species or population isolation may vary in different stages of speciation depending on evolutionary forces acting within species and through species' interactions. Genetic incompatibilities between interacting species are expected to reinforce prezygotic barriers in sympatric populations and lead to cascade reinforcement between conspecific populations living within and outside the areas of sympatry. We tested these predictions and studied whether and how the strength and target of reinforcement between Drosophila montana and Drosophila flavomontana vary between sympatric populations with different histories and species abundances. All barri…

0106 biological sciences0301 basic medicineSympatryReproductive IsolationReciprocal crossmedia_common.quotation_subjectPopulationZoologyBiology010603 evolutionary biology01 natural sciences03 medical and health sciencesSexual Behavior AnimalGeneticsAnimalseducationDrosophilaEcology Evolution Behavior and Systematicsmedia_commonPopulation DensityDrosophila montanaeducation.field_of_studyReproductive isolationbiology.organism_classificationBiological EvolutionSpeciationSympatry030104 developmental biologySympatric speciationDrosophilaGeneral Agricultural and Biological SciencesEvolution; international journal of organic evolution
researchProduct

Effects of photoperiodically induced reproductive diapause and cold hardening on the cold tolerance of Drosophila montana

2010

Coping with seasonal and daily variation in environmental conditions requires that organisms are able to adjust their reproduction and stress tolerance according to environmental conditions. Females of Drosophila montana populations have adapted to survive over the dark and cold winters at high latitudes and altitudes by spending this season in photoperiodically controlled reproductive diapause and reproducing only in spring/summer. The present study showed that flies of a northern population of this species are quite tolerant of low temperatures and show high seasonal and short-term plasticity in this trait. Culturing the flies in short day length (nearly all females in reproductive diapau…

MaleLightPhysiologyCold tolerancePhotoperiodPopulationZoologyCold treatmentDiapauseBiologymedicineAnimalsDay lengtheducationDrosophila montanaeducation.field_of_studyEcologyReproductionfungiSeasonalitymedicine.diseaseCold TemperatureDrosophila melanogasterInsect ScienceFemaleCold hardeningJournal of Insect Physiology
researchProduct

Transcriptional Differences between Diapausing and Non-Diapausing D. montana Females Reared under the Same Photoperiod and Temperature

2016

Background A wide range of insects living at higher latitudes enter diapause at the end of the warm season, which increases their chances of survival through harsh winter conditions. In this study we used RNA sequencing to identify genes involved in adult reproductive diapause in a northern fly species, Drosophila montana. Both diapausing and non-diapausing flies were reared under a critical day length and temperature, where about half of the emerging females enter diapause enabling us to eliminate the effects of varying environmental conditions on gene expression patterns of the two types of female flies. Results RNA sequencing revealed large differences between gene expression patterns of…

0301 basic medicinePhysiologyMolecular biologylcsh:MedicineDiapause InsectBiochemistryTranscriptomeSequencing techniquesCytochrome P-450 Enzyme SystemGlucose MetabolismLääketieteen bioteknologia - Medical biotechnologyGene expressionMedicine and Health SciencesDrosophila Proteinsgeeniekspressiolcsh:SciencegenesOverwinteringGeneticsMultidisciplinaryBiolääketieteet – BiomedicinebiologyReproductionDrosophila MelanogasterMetamorphosis BiologicalTemperatureInsect physiologyRNA sequencingAnimal ModelsGenomicsPhenotypeOvariesInsectsCarbohydrate MetabolismDrosophilaFemaleAnatomyDrosophila melanogasterTranscriptome AnalysisResearch ArticleArthropodaPhotoperiodMyosinsDiapause03 medical and health sciencesExtraction techniquesModel OrganismsDrosophila montanaGeneticsAnimalsGenegeenitta1184lcsh:RReproductive SystemOrganismsBiology and Life SciencesComputational BiologyGenome Analysisbiology.organism_classificationInvertebratesActinsRNA extractionResearch and analysis methodsdiapauseMolecular biology techniquesMetabolism030104 developmental biologygene expressionta1181lcsh:QPhysiological ProcessesDevelopmental BiologyPLoS ONE
researchProduct

Photosensitive Alternative Splicing of the Circadian Clock Gene timeless Is Population Specific in a Cold-Adapted Fly, Drosophila montana

2018

sopeutuminenalternative splicinglight-dark cyclegeenitpopulaatiogenetiikkamahlakärpäsetta1184ta1181temperatureDrosophila MontanaphotoperiodvuorokausirytmiG3: Genes, Genomes, Genetics
researchProduct

Genetic and phenotypic divergence in Drosophila virilis and D. montana

2007

Tapahtuuko lajien toisistaan erillään olevien populaatioiden ilmiasuun liittyvien piirteiden eriytyminen populaatioiden geneettisen eriytymisen sivutuotteena vai nopeutuuko tällaisten piirteiden eriytyminen luonnonvalinnan tai seksuaalivalinnan vaikutuksesta? Tätä kysymystä Jarkko Routtu pohti väitöskirjassaan. Routtu tutki maapallon eri puolilta peräisin olevien mahlakärpäskantojen eriytymistä, D. virilis -lajilla koiraan kosintalaulun ja D. montana -lajilla koiraan kosintalaulun sekä siipien ja genitaalien koon ja muodon perusteella.- Erityisesti Drosophila montanalla seksuaalivalinnan vaikutus populaatioiden eriytymiseen on kiinnostavaa, koska tämän lajin naaraat ovat mieltyneet koiraan …

Drosophila montanamahlakärpäsetDrosophila virilispopulaatigenetiikkakärpäset
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct

The genetic architecture of sexually selected traits in two natural populations of Drosophila montana

2015

The work was supported by the National Environment Research Council (grant NE/E015255/1 to MGR and RKB) and the Academy of Finland (project 132619 to AH). We investigated the genetic architecture of courtship song and cuticular hydrocarbon traits in two phygenetically distinct populations of Drosophila montana. To study natural variation in these two important traits, we analysed within-population crosses among individuals sampled from the wild. Hence, the genetic variation analysed should represent that available for natural and sexual selection to act upon. In contrast to previous between-population crosses in this species, no major quantitative trait loci (QTLs) were detected, perhaps be…

MaleGenotypeQH301 BiologyQuantitative Trait LociPopulationQuantitative trait locusPolymorphism Single NucleotideSexual Behavior AnimalQH301Drosophila montanaGenetic variationGeneticsAnimalssexual selectionAlleleeducationDrosophilaGenetics (clinical)Geneticseducation.field_of_studybiologycourtship songta1184Chromosome MappingGenetic Variationbiology.organism_classificationgenetic architectureGenetic architectureGenetics PopulationPhenotypeSexual selectionTraitta1181DrosophilaFemaleOriginal ArticleTranscriptomeHeredity
researchProduct

Age-related decrease in male reproductive success and song quality in Drosophila montana

2007

In the present paper, we have studied the effects of aging on male reproductive success and song quality in Drosophila montana .W e analyzed the reproductive success of wild-caught males at their normal breeding age during the mating season and after maintaining the males in laboratory from 1 to 5 months. In line with the mutation accumulation theory of aging, none of the factors affecting the reproductive success of wild-caught males during the mating season were related to male longevity. However, mating activity and progeny production of the males decreased with male age. Interestingly, there was no significant variation in progeny production between males at their normal breeding age, w…

Drosophila montanaReproductive successEcologymedia_common.quotation_subjectLongevityBiologyHaremMale ageAge relatedSeasonal breederAnimal Science and ZoologyMatingEcology Evolution Behavior and Systematicsmedia_commonDemographyBehavioral Ecology
researchProduct

Sexual selection on song and cuticular hydrocarbons in two distinct populations of Drosophila montana

2011

Sexual selection has the potential to contribute to population divergence and speciation. Most studies of sexual selection in Drosophila have concentrated on a single signaling modality, usually either courtship song or cuticular hydrocarbons (CHCs), which can act as contact pheromones. We have examined the relationship between both signal types and reproductive success using F1–3 offspring of wild- collected flies, raised in the lab. We used two populations of the Holarctic species Drosophila montana that represent different phylogeographic clades that have been separate for ca. 0.5 million years (MY), and differ to some extent in both traits. Here, we characterize the nature and identify …

selection analysisQLkutikulan hiilivedytseksuaalinen valintaSelection analysiscuticular hydrocarbonsQL ZoologyCourtship songsukupuolivalintaSexual selectionkosintalauluDrosophila montanavalinta-analyysibehavior and behavior mechanismssexual selectionCuticular hrdocarbonsOriginal Research
researchProduct

Inter- and intra-specific genomic divergence in Drosophila montana shows evidence for cold adaptation

2018

This work was supported by the Academy of Finland to AH (projects 132619 and 267244) and to MK (projects 268214 and 272927) and NERC (UK) funding to MGR (grants NE/E015255/1 and NE/J020818/1) and PhD studentship to DJP (NE/I528634/1). The genomes of species that are ecological specialists will likely contain signatures of genomic adaptation to their niche. However, distinguishing genes related to ecological specialism from other sources of selection and more random changes is a challenge. Here we describe the genome of Drosophila montana, which is the most extremely cold-adapted Drosophila species. We use branch tests to identify genes showing accelerated divergence in contrasts between col…

0106 biological sciences0301 basic medicineQH301 BiologyAcclimatizationGenome Insectcomparative genomics01 natural sciencesGenomekylmänkestävyysDrosophilia montanaPhylogenysopeutuminen0303 health scienceseducation.field_of_studybiologygenomiikkaCold TemperatureDrosophilaSynonymous substitutionResearch ArticlemahlakärpäsetNichePopulationGenomics010603 evolutionary biologyIntraspecific competitionQH30103 medical and health sciencesecological adaptationPhylogeneticsDrosophila montanaGeneticsAnimalsDrosophila (subgenus)educationGeneEcology Evolution Behavior and Systematics030304 developmental biologyComparative genomicsta1184DASMolecular Sequence Annotationcold tolerancebiology.organism_classificationDiapauseAcclimatization; Animals; Cold Temperature; Diapause; Drosophila/classification; Drosophila/genetics; Drosophila/physiology; Genome Insect; Molecular Sequence Annotation; Phylogeny030104 developmental biologyEvolutionary biologyta1181Adaptation
researchProduct